Accesso libero

The effects of Guarana (Paullinia cupana) supplementation on the cognitive performance of young healthy adults – a Systematic Review

 e   
13 set 2019
INFORMAZIONI SU QUESTO ARTICOLO

Cita
Scarica la copertina

American Chemical Society 1155 Sixteenth Street, N.W. Washington, D.C. 20036 T [202] 872-6042 F [202] 872 4370 https://www.acs.orgAmerican Chemical Society 1155 Sixteenth StreetN.W. Washington, D.C20036 T [202] 872-6042 F [202] 872 4370https://www.acs.orgSearch in Google Scholar

BAGOT KS, KAMINER Y (April 2014). ‘Efficacy of stimulants for cognitive enhancement in non-attention deficit hyperactivity disorder youth: a systematic review’. Addiction. 109 (4): 547–557BAGOTKSKAMINERYApril2014‘Efficacy of stimulants for cognitive enhancement in non-attention deficit hyperactivity disorder youth: a systematic review’Addiction109454755710.1111/add.12460Search in Google Scholar

BEMPONG DK, HOUGHTON PJ, STEADMAN K (1993). ‘The xanthine content of guarana and its preparations’. INT. J. Pharmacog. 31 (3): 175–81BEMPONGDKHOUGHTONPJSTEADMANK1993‘The xanthine content of guarana and its preparations’INT. J. Pharmacog3131758110.3109/13880209309082937Search in Google Scholar

BOLTON, SANFORD; NULL, GARY (1981). ‘Caffeine: Psychological Effects, Use and Abuse’. Orthomolecular Psychiatry. 10 (3): 202-211BOLTONSANFORDNULLGARY1981‘Caffeine: Psychological Effects, Use and Abuse’Orthomolecular Psychiatry103202211Search in Google Scholar

‘Botanical Aspects’. International Coffee Organization. (2011)‘Botanical Aspects’. International Coffee Organization2011Search in Google Scholar

CAMBRIDGE DICTIONARY https://dictionary.cambridge.org/dictionary/english/coffeeCAMBRIDGE DICTIONARYhttps://dictionary.cambridge.org/dictionary/english/coffeeSearch in Google Scholar

CAPPELLETTI S, DARIA P, SANI G, AROMATARIO M (2015) ‘Caffeine: Cognitive and Physical Performance Enhancer or Psychoactive Drug?’. Current Neuropharmacology. 13 (1): 71–88. Coffee: World Markets and Trade (PDF) United States Department of Agriculture-Foreign Agricultural Service June 16, 2017CAPPELLETTISDARIAPSANIGAROMATARIOM2015‘Caffeine: Cognitive and Physical Performance Enhancer or Psychoactive Drug?’Current Neuropharmacology1317188Coffee: World Markets and Trade (PDF) United States Department of Agriculture-Foreign Agricultural Service June 16, 201710.2174/1570159X13666141210215655Search in Google Scholar

DUCHAN E, PATEL ND, FEUCHT C, (2010) ‘Energy drinks: a review of use and safety for athletes’. The Physician and Sportsmedicine 38(2):171–9DUCHANEPATELNDFEUCHTC2010‘Energy drinks: a review of use and safety for athletes’The Physician and Sportsmedicine382171910.3810/psm.2010.06.1796Search in Google Scholar

E-IMPORTS http://www.e-importz.com/coffee-statistics.phpE-IMPORTShttp://www.e-importz.com/coffee-statistics.phpSearch in Google Scholar

ESPINOLA E., DIAS R., MATTEI R., CARLINI E. (1997) ‘Pharmacological activity of Guarana (Paullinia cupana) in laboratory animals’. J. Ethonopharmacol. 55:223–229ESPINOLAE.DIASR.MATTEIR.CARLINIE.1997‘Pharmacological activity of Guarana (Paullinia cupana) in laboratory animals’J. Ethonopharmacol5522322910.1016/S0378-8741(96)01506-1Search in Google Scholar

FRATI P, KYRIAKOU C, DELI RIO A, MARINELLI E, VERGALLO GM, ZAAMI S, BUSARDO FP (JANUARY 2015) ‘Smart drugs and synthetic androgens for cognitive and physical enhancement: revolving doors of cosmetic neurology’. Curr Neuropharmacol. 13 (1): 5–11FRATIPKYRIAKOUCDELI RIOAMARINELLIEVERGALLOGMZAAMISBUSARDOFPJANUARY2015‘Smart drugs and synthetic androgens for cognitive and physical enhancement: revolving doors of cosmetic neurology’Curr Neuropharmacol13151110.2174/1570159X13666141210221750446204326074739Search in Google Scholar

FROESTL W, MUHS A, PFEIFER A (2014). ‘Cognitive enhancers (Nootropics). Part 1: drugs interacting with receptors. Update 2014’. Journal of Alzheimer’s Disease. 2014;41(4):961–1019FROESTLWMUHSAPFEIFERA2014‘Cognitive enhancers (Nootropics). Part 1: drugs interacting with receptors. Update 2014’Journal of Alzheimer’s Disease2014414961101910.3233/JAD-14022824898652Search in Google Scholar

Future Market Insights (fmi) (2016) ‘Global Guarana Market Value to Increase for US$ 3.4 Bn in 201 to US$ 7.4 Bn by 2026, Driven by Growing Consumer Preferences for Energy Drinks.’ (2016) https://www.futuremarketinsights.com/press-release/guarana-marketFuture Market Insights (fmi)2016‘Global Guarana Market Value to Increase for US$ 3.4 Bn in 201 to US$ 7.4 Bn by 2026, Driven by Growing Consumer Preferences for Energy Drinks.’ (2016)https://www.futuremarketinsights.com/press-release/guarana-marketSearch in Google Scholar

GALDUROZ JC, CARLINI EDE A (1994) ‘Acute effects of the PAULINIA CUPANA. “Guarana” on the cognition of normal volunteers.’ Sao Paulo Med J. 1994 Jul-Sep; 112(3):607–11GALDUROZJCCARLINI EDEA1994‘Acute effects of the PAULINIA CUPANA. “Guarana” on the cognition of normal volunteers.’Sao Paulo Med J1994 Jul-Sep11236071110.1590/S1516-318019940003000077638522Search in Google Scholar

GENG J, DONG J, NI H, LEE MS, WU T, JIANG K, WANG G, ZHOU AL, MALOUF R ‘Ginseng for cognition.’ 2010 Dec 8;(12) Cochrane Database Syst. Rev.GENGJDONGJNI HLEEMSWUTJIANGKWANGGZHOUALMALOUFR‘Ginseng for cognition.’2010Dec 8;(12)Cochrane Database Syst. Rev10.1002/14651858.CD007769Search in Google Scholar

GRGIC J, TREXLER ET, LAZINICA B, PEDISC Z (2018) ‘Effects of caffeine intake on muscle strength and power: a systematic review and meta-analysis’. Journal of the International Society of Sports Nutrition 15:11GRGICJTREXLERETLAZINICABPEDISCZ2018‘Effects of caffeine intake on muscle strength and power: a systematic review and meta-analysis’Journal of the International Society of Sports Nutrition151110.1186/s12970-018-0216-0583901329527137Search in Google Scholar

GRIMA NA, PASE MP, MACPHERSON H, PIPINGAS A ‘The effects of multivitamins on cognitive performance: a systematic review and meta-analysis.’ J Alzheimers Dis. 2012;29(3):561–9GRIMANAPASEMPMACPHERSONHPIPINGASA‘The effects of multivitamins on cognitive performance: a systematic review and meta-analysis.’J Alzheimers Dis2012293561910.3233/JAD-2011-111751Search in Google Scholar

HASKELL C.F., KENNEDY D.O., MILNE A.L., WESNES K.A., SCHOLEY A.B. (2006) ‘The acute behavioral effects of guarana’. Appetite 47:265HASKELLC.F.KENNEDYD.O.MILNEA.L.WESNESK.A.SCHOLEYA.B.2006‘The acute behavioral effects of guarana’Appetite4726510.1016/j.appet.2006.07.028Search in Google Scholar

HASKELL C.F., KENNEDY D.O., WESNES K.A., MILNE A.L., SCHOLEY A.B. (2007) ‘A double-blind, placebo-controlled, multi-dose evaluation of the acute behavioral effects of Guarana in humans’. J. Psychopharmacol. 21:65–70HASKELLC.F.KENNEDYD.O.WESNESK.A.MILNEA.L.SCHOLEYA.B.2007‘A double-blind, placebo-controlled, multi-dose evaluation of the acute behavioral effects of Guarana in humans’J. Psychopharmacol21657010.1177/0269881106063815Search in Google Scholar

HEISHMAN SJ, KLEYKAMP BA, SINGLETON EG (JUNE 2010). ‘Meta-analysis of the acute effects of nicotine and smoking on human performance’ J Psychopharmacology. 210 (4): 453–69HEISHMANSJKLEYKAMPBASINGLETONEGJUNE2010‘Meta-analysis of the acute effects of nicotine and smoking on human performance’J Psychopharmacology21044536910.1007/s00213-010-1848-1Search in Google Scholar

HERRAIZ TOMAS, CHAPARRO CAROLINA 2006 ‘Human monoamine oxidase enzyme inhibition by coffee and β-carbolines norharman and harman isolated from coffee’ Life Sciences. 78(8): 795–802TOMASHERRAIZCAROLINACHAPARRO2006‘Human monoamine oxidase enzyme inhibition by coffee and β-carbolines norharman and harman isolated from coffee’Life Sciences78879580210.1016/j.lfs.2005.05.074Search in Google Scholar

H. P. Rang M. M. Dale J. M. Ritter R. J. Flower G. Henderson ‘Rang and Dale’s Pharmacology’. 2012 7th edition Elvesier Inc. Unit 4 Chapter 47 Pages used:642–647RangH. P.DaleM. M.RitterJ. M.FlowerR. J.HendersonG.‘Rang and Dale’s Pharmacology’20127th editionElvesier IncUnit 4 Chapter 47 Pages used642647Search in Google Scholar

Jacob Cohen (1988) ‘Statistical Power Analysis for the Behavioral Sciences’ (2nd ed.), New Jersey: Lawrence Erlbaum AssociatesJacobCohen1988‘Statistical Power Analysis for the Behavioral Sciences’2nd edNew JerseyLawrence Erlbaum AssociatesSearch in Google Scholar

Julian P T Higgins, Douglas G Altman, Peter C Gøtzsche, Peter Jüni, David Moher, Andrew D Oxman, Jelena Savović, Kenneth F Schulz, Laura Weeks, Jonathan A C Sterne, Cochrane Bias Methods Group Cochrane Statistical Methods Group ‘The Cochrane Collaboration’s tool for assessing risk of bias in randomised trials’ BMJ 2011;343:d5928HigginsJulian P TAltmanDouglas GGøtzschePeter CJüniPeterMoherDavidOxmanAndrew DSavovićJelenaSchulzKenneth FWeeksLauraSterneJonathan A CCochrane Bias Methods Group Cochrane Statistical Methods Group ‘The Cochrane Collaboration’s tool for assessing risk of bias in randomised trials’BMJ2011343d592810.1136/bmj.d5928Search in Google Scholar

Keith A. Wesnes 2000 ‘The value of assessing cognitive function in drug development’ 2000 Sep; 2(3): 183–202. Dialogues Clin. Neurosci.WesnesKeith A.2000‘The value of assessing cognitive function in drug development’2000 Sep23183202Dialogues Clin. Neurosci10.31887/DCNS.2000.2.3/kwesnesSearch in Google Scholar

KENNEDY D.O., HASKELL C.F., WESNES K.A., SCHOLEY A.B. (2004) ‘Improved cognitive performance in human volunteers following administration of Guarana (Paullinia cupana) extract: Comparison and interaction with Panax ginseng’. Pharmacol. Biochem. Behav. 79:401–411KENNEDYD.O.HASKELLC.F.WESNESK.A.SCHOLEYA.B.2004‘Improved cognitive performance in human volunteers following administration of Guarana (Paullinia cupana) extract: Comparison and interaction with Panax ginseng’Pharmacol. Biochem. Behav7940141110.1016/j.pbb.2004.07.014Search in Google Scholar

KENNEDY DO, HASKELL CF, ROBERTSON B, REAY J, BREWSTER-MAUND C, LUEDEMANN J, MAGGINI S, RUF M, ZANGARA A, SCHOLEY AB (2008) ‘Improved cognitive performance and mental fatigue following a multi-vitamin and mineral supplement with added guarana (Paullinia cupana)’. Appetite 2008 50(2-3):506–13KENNEDYDOHASKELLCFROBERTSONBREAYJBREWSTER-MAUNDCLUEDEMANNJMAGGINISRUFMZANGARAASCHOLEYAB2008‘Improved cognitive performance and mental fatigue following a multi-vitamin and mineral supplement with added guarana (Paullinia cupana)’Appetite 2008502-35061310.1016/j.appet.2007.10.007Search in Google Scholar

LIGUORI A., HUGHES J.R, GRASS J.A (1997) ‘Absorption and subjective effects of caffeine from coffee, cola and capsules’. Pharmacol. Biochem. Behav 58:721–726LIGUORIA.HUGHESJ.RGRASSJ.A1997‘Absorption and subjective effects of caffeine from coffee, cola and capsules’Pharmacol. Biochem. Behav5872172610.1016/S0091-3057(97)00003-8Search in Google Scholar

MOHER D, LIBERATI A, TETZLAFF J, ALTMAN DG, THE PRISMA GROUP (2009) ‘Preferred Reporting Items for Systematic Reviews and Meta-Analyses: The PRISMA Statement.’ Journal of Clinical Epidemiology 2009MOHERDLIBERATIATETZLAFFJALTMANDGTHE PRISMA GROUP2009‘Preferred Reporting Items for Systematic Reviews and Meta-Analyses: The PRISMA Statement.’Journal of Clinical Epidemiology200910.1016/j.jclinepi.2009.06.00519631508Search in Google Scholar

NATHANSON JA (October 1984). ‘Caffeine and related methylxanthines: possible naturally occurring pesticides’. Science. 226(4671): 184–7NATHANSONJAOctober1984‘Caffeine and related methylxanthines: possible naturally occurring pesticides’Science2264671184710.1126/science.62075926207592Search in Google Scholar

NEHLIG A (2010) ‘Is caffeine a cognitive enhancer?’ J. Alzheimer’s Dis. 20:85–94NEHLIGA2010‘Is caffeine a cognitive enhancer?’ JAlzheimer’s Dis20859410.3233/JAD-2010-09131520182035Search in Google Scholar

NOOR AZUIN SULIMAN, CHE NORMA MAT TAIB, MAHAMAD ARIS MOHD MOKLAS, MOHD IIHAM ADENAN, MOHAMAD TAUFIK HIDAYAT BAHARULDIN, RUSLIZA BASIR (2016) ‘Establishing Natural Nootropics: Recent Molecular Enhancement Influenced by Natural Nootropic.’ Evid. Based Complement Alternat Med. 2016: 4391375.SULIMANNOOR AZUINTAIBCHE NORMA MATMOKLASMAHAMAD ARIS MOHDADENANMOHD IIHAMBAHARULDINMOHAMAD TAUFIK HIDAYATBASIRRUSLIZA2016‘Establishing Natural Nootropics: Recent Molecular Enhancement Influenced by Natural Nootropic.’Evid. Based Complement Alternat Med2016439137510.1155/2016/4391375502147927656235Search in Google Scholar

Oxford Dictionary ‘cognition - definition of cognition in English from the Oxford dictionary’ Link: https://en.oxforddictionaries.com/definition/cognitionOxford Dictionary ‘cognition - definition of cognition in English from the Oxford dictionary’ Linkhttps://en.oxforddictionaries.com/definition/cognitionSearch in Google Scholar

POMPORTES L, BRISSWALTER J, CASINI L, HAYS A, DAVRANCHE K (2017) ‘Cognitive performance Enhancement Induced by Caffeine, Carbohydrate and Guarana Mouth Rinsing during Submaximal Exercise’. Nutrients 2017 9(6)POMPORTESLBRISSWALTERJCASINILHAYSADAVRANCHEK2017‘Cognitive performance Enhancement Induced by Caffeine, Carbohydrate and Guarana Mouth Rinsing during Submaximal Exercise’Nutrients20179610.3390/nu9060589549056828598402Search in Google Scholar

POMPORTES L, DAVRANCHE K, BRISSWALTER I, HAYS A, BRISSWALTER J (2014) ‘Heart rate variability and cognitive function following a multi-vitamin and mineral supplementation with added guarana (Paullinia cupana).’ Nutrients 2014 Dec 31; 7(1): 196–208POMPORTESLDAVRANCHEKBRISSWALTERIHAYSABRISSWALTERJ2014‘Heart rate variability and cognitive function following a multi-vitamin and mineral supplementation with added guarana (Paullinia cupana).’Nutrients2014 Dec 317119620810.3390/nu7010196430383325558905Search in Google Scholar

ROFFIE J, CORTE DOS SANTOS A, MEXIA J.T., BUSSON F, MIAGROT M (1973) ▯CAFÉ VERTS ET TORREFIESDE I Angola▯ Etude chimique 5th International Colloquium Chemicum Coffee, Lisboa 14 June to 19 June 1971. ASIC pp. 179–200ROFFIEJCORTE DOS SANTOSAMEXIAJ.T.BUSSONFMIAGROTM1973▯CAFÉ VERTS ET TORREFIESDE I Angola▯ Etude chimique 5th International Colloquium Chemicum Coffee, Lisboa 14 June to 19 June 1971ASICpp179200Search in Google Scholar

SCHOLEY A, BAUER I, NEALE C, SAVAGE K, CAMFIELD D, WHITE D, MAGGINI S, PIPINGAS A, STOUGH C, HUGHES M. (2013) ’Acute effects of different multivitamin mineral preparations with and without Guarana on mood, cognitive performance, and functional brain activation’. Nutrients 2013 5(9):3589–3604SCHOLEYABAUERINEALECSAVAGEKCAMFIELDDWHITEDMAGGINISPIPINGASASTOUGHCHUGHESM2013’Acute effects of different multivitamin mineral preparations with and without Guarana on mood, cognitive performance, and functional brain activation’Nutrients 2013593589360410.3390/nu5093589379892324067387Search in Google Scholar

SPENCER RV, DEVILBISS DM, BERRIDGE CW (JUNE 2015) ‘The Cognition-Enhancing Effects of Psychostimulants Involve Direct Action in the Prefrontal Cortex’. Biol. Psychiatry. 77 (11): 940–950SPENCERRVDEVILBISSDMBERRIDGECWJUNE2015‘The Cognition-Enhancing Effects of Psychostimulants Involve Direct Action in the Prefrontal Cortex’Biol. Psychiatry771194095010.1016/j.biopsych.2014.09.013437712125499957Search in Google Scholar

Thebmj ‘Cognitive decline can begin as early as age 45, warn experts.’ January 5 2012 https://www.bmj.com/press-releases/2012/01/05/cognitive-decline-can-begin-early-age-45-warn-expertsThebmj ‘Cognitive decline can begin as early as age 45, warn experts.’ January 52012https://www.bmj.com/press-releases/2012/01/05/cognitive-decline-can-begin-early-age-45-warn-expertsSearch in Google Scholar

TOM M McLELLAN, JOHN A CALDWELL, HARRIES R LIBERMAN (2016) ‘A review of caffeine’s effects on cognitive, physical and occupational performance’ Neuroscience & Biobehavioral Reviews Volume 71 December 2016, Pages 294–312McLELLANTOM MCALDWELLJOHN ALIBERMANHARRIES R2016‘A review of caffeine’s effects on cognitive, physical and occupational performance’Neuroscience & Biobehavioral ReviewsVolume 71December 2016, Pages29431210.1016/j.neubiorev.2016.09.00127612937Search in Google Scholar

VAN DEN EYDE F, VAN BAELEN PC, PORTZKY M, AUDENAERT K (2008) ‘Energy drink effects on cognitive performance’ Tijdschrift voor Psychiatrie. 50VAN DEN EYDEFVAN BAELENPCPORTZKYMAUDENAERTK2008‘Energy drink effects on cognitive performance’Tijdschrift voor Psychiatrie50Search in Google Scholar

VEASEY RC, HASKELL-RAMSAY CF, KENNEDY DO, WISHART K, MAGGINI S, FUCHS CJ, STEVENSON EJ (2015) ‘The effects of supplementation with a Vitamin and Mineral Complex with Guarana Prior to Fasted Exercise on Affect, Exertion, Cognitive Performance, and Substrate Metabolism: A Randomized Controlled Trial.’ Nutrients 2015 Jul 27; 7(8):6109–27VEASEYRCHASKELL-RAMSAYCFKENNEDYDOWISHARTKMAGGINISFUCHSCJSTEVENSONEJ2015‘The effects of supplementation with a Vitamin and Mineral Complex with Guarana Prior to Fasted Exercise on Affect, Exertion, Cognitive Performance, and Substrate Metabolism: A Randomized Controlled Trial.’Nutrients2015 Jul 277861092710.3390/nu7085272455511126225993Search in Google Scholar

WebMD 2017 Medical Reference Reviewed by Carmen Patrick MohanWebMD2017Medical Reference Reviewed by Carmen Patrick MohanSearch in Google Scholar

WEIDNER M, MAIER HG (1999) ‘Seltene Purinalkaloide in Roestkaffee’ Lebensmittelchemie Vol 53, 3 p 58WEIDNERMMAIERHG1999‘Seltene Purinalkaloide in Roestkaffee’LebensmittelchemieVol 533p58Search in Google Scholar

WHITE DJ, CAMFIELD DA, MAGGINI S, PIPINGAS A, SILBERSTEIN R, STOUGH C, SCHOLEY A (2017) ‘The effect of a single dose of multivitamin and mineral combination with and without guarana on functional brain activity during a continuous performance task.’ Nutr Neurosci 2017 Jan; 20(1):8–22WHITEDJCAMFIELDDAMAGGINISPIPINGASASILBERSTEINRSTOUGHCSCHOLEYA2017‘The effect of a single dose of multivitamin and mineral combination with and without guarana on functional brain activity during a continuous performance task.’Nutr Neurosci2017 Jan20182210.1179/1476830514Y.000000015725259737Search in Google Scholar

WOOD S, SAGE JR, SHUMAN T, ANAGNOSTARAS SG (January 2014). ‘Psychostimulants and cognition: a contiunuum of behavioral and cognitive activation’. Pharmacol. Rev. 66 (1):193–221WOODSSAGEJRSHUMANTANAGNOSTARASSGJanuary2014‘Psychostimulants and cognition: a contiunuum of behavioral and cognitive activation’Pharmacol. Rev66119322110.1124/pr.112.007054388046324344115Search in Google Scholar